Lineage for d3d3cc_ (3d3c C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719093Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
    automatically mapped to Pfam PF01029
  6. 2719109Protein automated matches [190997] (1 species)
    not a true protein
  7. 2719110Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries)
  8. 2719117Domain d3d3cc_: 3d3c C: [173661]
    automated match to d1ey1a_
    protein/RNA complex

Details for d3d3cc_

PDB Entry: 3d3c (more details), 2.6 Å

PDB Description: structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
PDB Compounds: (C:) N utilization substance protein B

SCOPe Domain Sequences for d3d3cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d3cc_ a.79.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
epaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatntay
ldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedshk
fvngvldkaapvirpnkk

SCOPe Domain Coordinates for d3d3cc_:

Click to download the PDB-style file with coordinates for d3d3cc_.
(The format of our PDB-style files is described here.)

Timeline for d3d3cc_: