Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
Protein Grancalcin [47550] (1 species) Calpain small subunit homologue |
Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries) |
Domain d1f4ob_: 1f4o B: [17363] complexed with ca |
PDB Entry: 1f4o (more details), 2.5 Å
SCOPe Domain Sequences for d1f4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ob_ a.39.1.8 (B:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai
Timeline for d1f4ob_: