Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein Pheromone-binding protein asp1 [101192] (1 species) |
Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (15 PDB entries) |
Domain d3cz0b_: 3cz0 B: [173555] automated match to d1r5ra_ complexed with 9od, cl, gol, mg |
PDB Entry: 3cz0 (more details), 1.7 Å
SCOPe Domain Sequences for d3cz0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cz0b_ a.39.2.1 (B:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]} wvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddea nvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Timeline for d3cz0b_: