SCOPe 2.07: Domain d3curb_: 3cur B:

Lineage for d3curb_ (3cur B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)

8. Domain d3curb_: 3cur B: [173473]
   Other proteins in same PDB: d3curh_, d3curi_, d3curj_
   automated match to d1frfs_
   complexed with f3s, fco, gol, mg, ni, per, sf4; mutant

Details for d3curb_

PDB Entry: 3cur, 2.4 Å

PDB Description: Structure of a double methionine mutant of NI-FE hydrogenase

PDB Compounds: (B:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d3curb_:

Sequence; same for both SEQRES and ATOM records:

>d3curb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

Timeline for d3curb_:

• d3curb_ first appeared in SCOPe 2.01
  
• d3curb_ appears in SCOPe 2.06
  
• d3curb_ appears in the current release, SCOPe 2.08