Lineage for d3cq2a_ (3cq2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947439Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2947450Family d.52.8.2: PaaD-like [117922] (3 proteins)
    Pfam PF01883; DUF59
  6. 2947458Protein automated matches [190571] (1 species)
    not a true protein
  7. 2947459Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries)
  8. 2947461Domain d3cq2a_: 3cq2 A: [173398]
    automated match to d2cu6a1

Details for d3cq2a_

PDB Entry: 3cq2 (more details), 1.9 Å

PDB Description: Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8
PDB Compounds: (A:) Putative uncharacterized protein TTHB138

SCOPe Domain Sequences for d3cq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cq2a_ d.52.8.2 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
leaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavrq
alsrlpgveevevevtfeppwtlarlsekarrllgw

SCOPe Domain Coordinates for d3cq2a_:

Click to download the PDB-style file with coordinates for d3cq2a_.
(The format of our PDB-style files is described here.)

Timeline for d3cq2a_: