SCOPe 2.06: Domain d3cnka_: 3cnk A:

Lineage for d3cnka_ (3cnk A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin a [141023] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141024] (7 PDB entries)
   Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328

8. Domain d3cnka_: 3cnk A: [173353]
   automated match to d1v05a_
   complexed with so4

Details for d3cnka_

PDB Entry: 3cnk, 1.65 Å

PDB Description: crystal structure of the dimerization domain of human filamin a

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d3cnka_:

Sequence; same for both SEQRES and ATOM records:

>d3cnka_ b.1.18.10 (A:) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
kvvakglglskayvgqkssftvdcskagnnmllvgvhgprtpceeilvkhvgsrlysvsy
llkdkgeytlvvkwghehipgspyrvvvp

Timeline for d3cnka_:

• d3cnka_ first appeared in SCOPe 2.01
  
• d3cnka_ appears in SCOPe 2.05
  
• d3cnka_ appears in SCOPe 2.07
  
• d3cnka_ appears in the current release, SCOPe 2.08