Lineage for d3clca_ (3clc A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913954Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 913955Protein automated matches [190907] (2 species)
    not a true protein
  7. 913956Species Enterobacter sp. [TaxId:211595] [189872] (2 PDB entries)
  8. 913959Domain d3clca_: 3clc A: [173309]
    automated match to d2b5ad1
    protein/DNA complex; complexed with mg

Details for d3clca_

PDB Entry: 3clc (more details), 2.8 Å

PDB Description: Crystal Structure of the Restriction-Modification Controller Protein C.Esp1396I Tetramer in Complex with its Natural 35 Base-Pair Operator
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d3clca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clca_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilk

SCOPe Domain Coordinates for d3clca_:

Click to download the PDB-style file with coordinates for d3clca_.
(The format of our PDB-style files is described here.)

Timeline for d3clca_: