Lineage for d3cjib_ (3cji B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1142046Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 1142047Protein automated matches [190988] (1 species)
    not a true protein
  7. 1142048Species Seneca valley virus [TaxId:390157] [188689] (1 PDB entry)
  8. 1142049Domain d3cjib_: 3cji B: [173278]
    automated match to d2mev3_
    complexed with ca

Details for d3cjib_

PDB Entry: 3cji (more details), 2.3 Å

PDB Description: Structure of Seneca Valley Virus-001
PDB Compounds: (B:) Polyprotein

SCOPe Domain Sequences for d3cjib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cjib_ b.121.4.0 (B:) automated matches {Seneca valley virus [TaxId: 390157]}
gpiptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervp
epvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitlt
fcgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyret
raitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

SCOPe Domain Coordinates for d3cjib_:

Click to download the PDB-style file with coordinates for d3cjib_.
(The format of our PDB-style files is described here.)

Timeline for d3cjib_: