SCOPe 2.06: Domain d3ci3a1: 3ci3 A:2-188

Lineage for d3ci3a1 (3ci3 A:2-188)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (6 species)
   not a true protein

7. Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries)

8. Domain d3ci3a1: 3ci3 A:2-188 [173246]
   Other proteins in same PDB: d3ci3a2
   automated match to d1rtyb_
   complexed with 3po, 5ad, b12, mg, na

Details for d3ci3a1

PDB Entry: 3ci3, 1.11 Å

PDB Description: Structure of the PduO-type ATP:co(I)rrinoid adenosyltransferase from Lactobacillus reuteri complexed with partial adenosylcobalamin and PPPi

PDB Compounds: (A:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d3ci3a1:

Sequence; same for both SEQRES and ATOM records:

>d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
nskdvfr

Timeline for d3ci3a1:

• d3ci3a1 first appeared in SCOPe 2.01, called d3ci3a_
  
• d3ci3a1 was called d3ci3a_ in SCOPe 2.05
  
• d3ci3a1 appears in SCOPe 2.07
  
• d3ci3a1 appears in the current release, SCOPe 2.08