Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
Protein automated matches [190652] (6 species) not a true protein |
Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
Domain d3ci1a1: 3ci1 A:2-188 [173245] Other proteins in same PDB: d3ci1a2 complexed with atp, b12, k, mg |
PDB Entry: 3ci1 (more details), 1.9 Å
SCOPe Domain Sequences for d3ci1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci1a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]} kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr nskdvfr
Timeline for d3ci1a1: