Lineage for d1tcob_ (1tco B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355357Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
    Duplication: made with two pairs of EF-hands
  6. 355361Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species)
  7. 355362Species Cow (Bos taurus) [TaxId:9913] [47531] (1 PDB entry)
  8. 355363Domain d1tcob_: 1tco B: [17324]
    Other proteins in same PDB: d1tcoa_, d1tcoc_
    complexed with ca, fe, fk5, myr, po4, zn

Details for d1tcob_

PDB Entry: 1tco (more details), 2.5 Å

PDB Description: ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)

SCOP Domain Sequences for d1tcob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcob_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Cow (Bos taurus)}
gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi
fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg
nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv

SCOP Domain Coordinates for d1tcob_:

Click to download the PDB-style file with coordinates for d1tcob_.
(The format of our PDB-style files is described here.)

Timeline for d1tcob_: