Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) |
Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
Protein automated matches [190839] (2 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [188434] (2 PDB entries) |
Domain d3cgzb_: 3cgz B: [173235] automated match to d1id0a_ |
PDB Entry: 3cgz (more details), 1.9 Å
SCOPe Domain Sequences for d3cgzb_:
Sequence, based on SEQRES records: (download)
>d3cgzb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} relhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackyc lefveisarqtddhlhifveddgpgiphskrslvfdrgqradtlrpgqgvglavareite qyagqiiasdsllggarmevvfgrqh
>d3cgzb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} relhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackyc lefveisarqtddhlhifveddgpgiphskrstlrpgqgvglavareiteqyagqiiasd sllggarmevvfgrqh
Timeline for d3cgzb_: