SCOPe 2.01: Domain d3cgya_: 3cgy A:

Lineage for d3cgya_ (3cgy A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (2 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [188434] (2 PDB entries)

8. Domain d3cgya_: 3cgy A: [173231]
   automated match to d1id0a_
   complexed with rdc

Details for d3cgya_

PDB Entry: 3cgy, 2.6 Å

PDB Description: Crystal Structure of Salmonella Sensor Kinase PhoQ catalytic domain in complex with radicicol

PDB Compounds: (A:) Virulence sensor histidine kinase phoQ

SCOPe Domain Sequences for d3cgya_:

Sequence, based on SEQRES records:

>d3cgya_ d.122.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
svllsrelhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldn
ackyclefveisarqtddhlhifveddgpgiphskrslvfdrgqradtlrpgqgvglava
reiteqyagqiiasdsllggarmevvfgrqhptqk

Sequence, based on observed residues (ATOM records):

>d3cgya_ d.122.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
svllsrelhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldn
ackyclefveisarqtddhlhifveddgpgipvglavareiteqyagqiiasdsllggar
mevvfgrqhptqk

Timeline for d3cgya_:

• d3cgya_ is new in SCOPe 2.01-stable
  
• d3cgya_ appears in SCOPe 2.02
  
• d3cgya_ appears in the current release, SCOPe 2.08, called d3cgya1