SCOPe 2.01: Domain d3cbyb_: 3cby B:

Lineage for d3cbyb_ (3cby B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d3cbyb_: 3cby B: [173125]
   automated match to d1l6oa_
   complexed with edo

Details for d3cbyb_

PDB Entry: 3cby, 1.5 Å

PDB Description: the dvl2 pdz domain in complex with the n1 inhibitory peptide

PDB Compounds: (B:) Dishevelled-2

SCOPe Domain Sequences for d3cbyb_:

Sequence, based on SEQRES records:

>d3cbyb_ b.36.1.1 (B:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

Sequence, based on observed residues (ATOM records):

>d3cbyb_ b.36.1.1 (B:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsdggiyigsimkggavaadgriepgdmllqvndmnfen
msnddavrvlrdivhkpgpivltvaksgwkdygwidgk

Timeline for d3cbyb_:

• d3cbyb_ is new in SCOPe 2.01-stable
  
• d3cbyb_ appears in SCOPe 2.02
  
• d3cbyb_ appears in the current release, SCOPe 2.08