SCOPe 2.01: Domain d3c9xa_: 3c9x A:

Lineage for d3c9xa_ (3c9x A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (4 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [188563] (1 PDB entry)

8. Domain d3c9xa_: 3c9x A: [173096]
   automated match to d1e5oe_
   complexed with gol

Details for d3c9xa_

PDB Entry: 3c9x, 1.7 Å

PDB Description: crystal structure of trichoderma reesei aspartic proteinase

PDB Compounds: (A:) Trichoderma reesei Aspartic protease

SCOPe Domain Sequences for d3c9xa_:

Sequence; same for both SEQRES and ATOM records:

>d3c9xa_ b.50.1.0 (A:) automated matches {Trichoderma reesei [TaxId: 51453]}
etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt
psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt
visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak
gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq
saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi
ginifgdvalkaalvvfdlgnerlgwaqk

Timeline for d3c9xa_:

• d3c9xa_ is new in SCOPe 2.01-stable
  
• d3c9xa_ appears in SCOPe 2.02
  
• d3c9xa_ appears in the current release, SCOPe 2.08