Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.4: SNARE-like [64356] (5 families) beta(2)-alpha-beta(3)-alpha(2) |
Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins) |
Protein automated matches [190918] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188402] (1 PDB entry) |
Domain d3bw6a1: 3bw6 A:1-135 [172874] Other proteins in same PDB: d3bw6a2 automated match to d1h8ma_ complexed with so4 |
PDB Entry: 3bw6 (more details), 2.5 Å
SCOPe Domain Sequences for d3bw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bw6a1 d.110.4.1 (A:1-135) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mriyyigvfrsggekalelsevkdlsqfgfferssvgqfmtffaetvasrtgagqrqsie egnyighvyarsegicgvlitdkeypvrpaytllnkildeylvahpkeewadvtetndal kmkqldtyiskyqdp
Timeline for d3bw6a1: