Lineage for d3bsuf_ (3bsu F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214149Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1214150Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1214204Family d.100.1.0: automated matches [191537] (1 protein)
    not a true family
  6. 1214205Protein automated matches [190913] (1 species)
    not a true protein
  7. 1214206Species Human (Homo sapiens) [TaxId:9606] [188388] (1 PDB entry)
  8. 1214210Domain d3bsuf_: 3bsu F: [172819]
    automated match to d1qhka_
    protein/DNA complex; protein/RNA complex; complexed with mg

Details for d3bsuf_

PDB Entry: 3bsu (more details), 2.1 Å

PDB Description: Hybrid-binding domain of human RNase H1 in complex with 12-mer RNA/DNA
PDB Compounds: (F:) Ribonuclease H1

SCOPe Domain Sequences for d3bsuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsuf_ d.100.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmfyavrrgrktgvfltwnecraqvdrfpaarfkkfatedeawafvrk

SCOPe Domain Coordinates for d3bsuf_:

Click to download the PDB-style file with coordinates for d3bsuf_.
(The format of our PDB-style files is described here.)

Timeline for d3bsuf_: