Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (3 families) |
Family d.100.1.0: automated matches [191537] (1 protein) not a true family |
Protein automated matches [190913] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188388] (1 PDB entry) |
Domain d3bsub_: 3bsu B: [172817] automated match to d1qhka_ protein/DNA complex; protein/RNA complex; complexed with mg |
PDB Entry: 3bsu (more details), 2.1 Å
SCOPe Domain Sequences for d3bsub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsub_ d.100.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmfyavrrgrktgvfltwnecraqvdrfpaarfkkfatedeawafvrk
Timeline for d3bsub_: