Lineage for d3bq7e1 (3bq7 E:1-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328565Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2328708Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2328709Protein automated matches [190031] (3 species)
    not a true protein
  7. 2328718Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2328776Domain d3bq7e1: 3bq7 E:1-67 [172786]
    Other proteins in same PDB: d3bq7a2, d3bq7c2, d3bq7e2
    automated match to d2f3na1

Details for d3bq7e1

PDB Entry: 3bq7 (more details), 2.9 Å

PDB Description: sam domain of diacylglycerol kinase delta1 (e35g)
PDB Compounds: (E:) Diacylglycerol kinase delta

SCOPe Domain Sequences for d3bq7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq7e1 a.60.1.0 (E:1-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvhlwgteevaawlehlslceykdiftrhdirgsgllhlerrdlkdlgvtkvghmkrilc
gikelsr

SCOPe Domain Coordinates for d3bq7e1:

Click to download the PDB-style file with coordinates for d3bq7e1.
(The format of our PDB-style files is described here.)

Timeline for d3bq7e1: