SCOP 1.73: Domain d1a75b_: 1a75 B:

Lineage for d1a75b_ (1a75 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (7 species)

7. Species Whiting (Merlangius merlangus) [TaxId:8058] [47499] (1 PDB entry)

8. Domain d1a75b_: 1a75 B: [17217]
   complexed with ace, ca

Details for d1a75b_

PDB Entry: 1a75, 1.9 Å

PDB Description: whiting parvalbumin

PDB Compounds: (B:) parvalbumin

SCOP Domain Sequences for d1a75b_:

Sequence; same for both SEQRES and ATOM records:

>d1a75b_ a.39.1.4 (B:) Parvalbumin {Whiting (Merlangius merlangus) [TaxId: 8058]}
afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka

Timeline for d1a75b_:

• d1a75b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a75b_ appears in SCOP 1.71
  
• d1a75b_ appears in SCOP 1.75
  
• d1a75b_ appears in the current release, SCOPe 2.08