Lineage for d1a75b_ (1a75 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3251Family a.39.1.4: Parvalbumin [47492] (2 proteins)
  6. 3256Protein Parvalbumin [47495] (6 species)
  7. 3285Species Whiting (Merlangius merlangus) [TaxId:8058] [47499] (1 PDB entry)
  8. 3287Domain d1a75b_: 1a75 B: [17217]

Details for d1a75b_

PDB Entry: 1a75 (more details), 1.9 Å

PDB Description: whiting parvalbumin

SCOP Domain Sequences for d1a75b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a75b_ a.39.1.4 (B:) Parvalbumin {Whiting (Merlangius merlangus)}
afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka

SCOP Domain Coordinates for d1a75b_:

Click to download the PDB-style file with coordinates for d1a75b_.
(The format of our PDB-style files is described here.)

Timeline for d1a75b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a75a_