PDB entry 1a75

View 1a75 on RCSB PDB site
Description: whiting parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, muscle protein
Deposited on 1998-03-19, released 1998-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2139
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin
    Species: Merlangius merlangus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a75a_
  • Chain 'B':
    Compound: parvalbumin
    Species: Merlangius merlangus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a75b_
  • Heterogens: CA, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a75A (A:)
    afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
    delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a75A (A:)
    agiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfieede
    lklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a75B (B:)
    afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
    delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka