![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (24 PDB entries) |
![]() | Domain d3abkv_: 3abk V: [171941] Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1occi_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abkv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abkv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d3abkv_:
![]() Domains from other chains: (mouse over for more information) d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkw_, d3abkx_, d3abky_, d3abkz_ |