Lineage for d3abko1 (3abk O:1-90)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456219Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1456220Species Cow (Bos taurus) [TaxId:9913] [81454] (24 PDB entries)
  8. 1456238Domain d3abko1: 3abk O:1-90 [198842]
    Other proteins in same PDB: d3abka_, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abko1

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3abko1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abko1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3abko1:

Click to download the PDB-style file with coordinates for d3abko1.
(The format of our PDB-style files is described here.)

Timeline for d3abko1: