Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily) 3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha |
Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) |
Family e.43.1.1: Capz alpha-1 subunit [90097] (2 proteins) |
Protein automated matches [191147] (1 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189295] (7 PDB entries) |
Domain d3aaaa_: 3aaa A: [171904] Other proteins in same PDB: d3aaab_, d3aaac_ automated match to d1izna_ complexed with ipa |
PDB Entry: 3aaa (more details), 2.2 Å
SCOPe Domain Sequences for d3aaaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aaaa_ e.43.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} sdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvkie gyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacdsal rayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitpptaqv aavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisenyq tmsdttfkalrrqlpvtrtkidwnkil
Timeline for d3aaaa_: