SCOPe 2.02: Domain d3aaaa_: 3aaa A:

Lineage for d3aaaa_ (3aaa A:)

1. Root: SCOPe 2.02

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
   3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha

4. Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families)

5. Family e.43.1.1: Capz alpha-1 subunit [90097] (2 proteins)

6. Protein automated matches [191147] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189295] (7 PDB entries)

8. Domain d3aaaa_: 3aaa A: [171904]
   Other proteins in same PDB: d3aaab_, d3aaac_
   automated match to d1izna_
   complexed with ipa

Details for d3aaaa_

PDB Entry: 3aaa, 2.2 Å

PDB Description: Crystal Structure of Actin capping protein in complex with V-1

PDB Compounds: (A:) F-actin-capping protein subunit alpha-1

SCOPe Domain Sequences for d3aaaa_:

Sequence; same for both SEQRES and ATOM records:

>d3aaaa_ e.43.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvkie
gyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacdsal
rayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitpptaqv
aavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisenyq
tmsdttfkalrrqlpvtrtkidwnkil

Timeline for d3aaaa_:

• d3aaaa_ first appeared in SCOPe 2.01
  
• d3aaaa_ appears in SCOPe 2.03
  
• d3aaaa_ appears in the current release, SCOPe 2.08