Lineage for d3a5ka_ (3a5k A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599809Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1599810Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1599892Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1600077Protein automated matches [190252] (3 species)
    not a true protein
  7. 1600078Species Human (Homo sapiens) [TaxId:9606] [187034] (21 PDB entries)
  8. 1600088Domain d3a5ka_: 3a5k A: [171753]
    automated match to d1bzja_
    complexed with mg

Details for d3a5ka_

PDB Entry: 3a5k (more details), 1.85 Å

PDB Description: crystal structure of protein-tyrosine phosphatase 1b
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d3a5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ka_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkwa
qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
svdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOPe Domain Coordinates for d3a5ka_:

Click to download the PDB-style file with coordinates for d3a5ka_.
(The format of our PDB-style files is described here.)

Timeline for d3a5ka_: