Lineage for d3a3fb1 (3a3f B:28-479)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014028Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 3014107Protein DD-carboxypeptidase DacB [144045] (2 species)
    Penicillin-binding protein 4
  7. 3014115Species Haemophilus influenzae [TaxId:727] [189139] (4 PDB entries)
  8. 3014121Domain d3a3fb1: 3a3f B:28-479 [171702]
    Other proteins in same PDB: d3a3fa2, d3a3fb2
    automated match to d2ex2a1
    complexed with fmz

Details for d3a3fb1

PDB Entry: 3a3f (more details), 2.1 Å

PDB Description: Crystal structure of penicillin binding protein 4 (dacB) from Haemophilus influenzae,complexed with novel beta-lactam (FMZ)
PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3a3fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3fb1 e.3.1.3 (B:28-479) DD-carboxypeptidase DacB {Haemophilus influenzae [TaxId: 727]}
invsdltqklpegsnagviakninqnqiiadyngstfmlpastqkvftavaaklalgdqf
qfetallsngkiqngnldgnlivsftgdpdltrgqlysllaelkkqgikkingdlvldts
vfsshdrglgwiwndltmcfnsppaaanidnncfyaeldanknpgeivkinvpaqfpiqv
fgqvyvadsneapycqldvvvhdnnryqvkgclarqykpfglsfavqntdayaaaiiqrq
lrklgiefngkvllpqkpqqgqllakhlskplpdllkkmmkksdnqiadslfravafnyy
krpasfqlgtlavksilqkqgirfgnsiladgsglsrhnlvapktmlsvleyiaknedkl
hlmetfpiagvdgtisgrgglispplvknviaktgslkgvynlagfmtnargekvafvqf
ingystgdlesktkraplvqfernlynelyky

SCOPe Domain Coordinates for d3a3fb1:

Click to download the PDB-style file with coordinates for d3a3fb1.
(The format of our PDB-style files is described here.)

Timeline for d3a3fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a3fb2