Class b: All beta proteins [48724] (177 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
Protein automated matches [190587] (7 species) not a true protein |
Species Polygonatum cyrtonema [TaxId:195526] [189271] (3 PDB entries) |
Domain d3a0cc_: 3a0c C: [171626] automated match to d1jpca_ |
PDB Entry: 3a0c (more details), 2 Å
SCOPe Domain Sequences for d3a0cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0cc_ b.78.1.0 (C:) automated matches {Polygonatum cyrtonema [TaxId: 195526]} vnslsspnslftghslevgpsyrlimqgdcnfvlydsgkpvwasntgglgsgcrltlhnn gnlviydqsnrviwqtktngkedhyvlvlqqdrnvviygpvvwatgsgp
Timeline for d3a0cc_: