Lineage for d3a02a_ (3a02 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1078589Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1078778Protein automated matches [190360] (2 species)
    not a true protein
  7. 1078779Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)
  8. 1078780Domain d3a02a_: 3a02 A: [171620]
    automated match to d1fjla_
    complexed with cd, cl

Details for d3a02a_

PDB Entry: 3a02 (more details), 1 Å

PDB Description: Crystal structure of Aristaless homeodomain
PDB Compounds: (A:) Homeobox protein aristaless

SCOPe Domain Sequences for d3a02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a02a_ a.4.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwr

SCOPe Domain Coordinates for d3a02a_:

Click to download the PDB-style file with coordinates for d3a02a_.
(The format of our PDB-style files is described here.)

Timeline for d3a02a_: