Lineage for d2zsfa_ (2zsf A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990584Species Mycobacterium tuberculosis [TaxId:1773] [189039] (10 PDB entries)
  8. 990593Domain d2zsfa_: 2zsf A: [171465]
    automated match to d1esma_
    complexed with act, adp, atp, flc, gol, na

Details for d2zsfa_

PDB Entry: 2zsf (more details), 2.8 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with ATP and ADP
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2zsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsfa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d2zsfa_:

Click to download the PDB-style file with coordinates for d2zsfa_.
(The format of our PDB-style files is described here.)

Timeline for d2zsfa_: