Lineage for d2zqqa_ (2zqq A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112573Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2112602Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 2112603Species Human (Homo sapiens) [TaxId:9606] [69441] (3 PDB entries)
  8. 2112604Domain d2zqqa_: 2zqq A: [171430]
    automated match to d1hzda_

Details for d2zqqa_

PDB Entry: 2zqq (more details), 2.2 Å

PDB Description: Crystal structure of human AUH (3-methylglutaconyl-coa hydratase) mixed with (AUUU)24A RNA
PDB Compounds: (A:) Methylglutaconyl-CoA hydratase

SCOPe Domain Sequences for d2zqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqqa_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
qtiptkdrlegllafkekrpprykge

SCOPe Domain Coordinates for d2zqqa_:

Click to download the PDB-style file with coordinates for d2zqqa_.
(The format of our PDB-style files is described here.)

Timeline for d2zqqa_: