![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein automated matches [190266] (7 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:70863] [188955] (1 PDB entry) |
![]() | Domain d2zqbd_: 2zqb D: [171424] automated match to d1rbra_ complexed with so4; mutant |
PDB Entry: 2zqb (more details), 2.49 Å
SCOPe Domain Sequences for d2zqbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqbd_ c.55.3.1 (D:) automated matches {Shewanella oneidensis [TaxId: 70863]} elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw vkghaghaenerchqlaraaaeanptqidtgy
Timeline for d2zqbd_: