Lineage for d2zqbb_ (2zqb B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1373756Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1373992Protein automated matches [190266] (7 species)
    not a true protein
  7. 1374007Species Shewanella oneidensis [TaxId:70863] [188955] (1 PDB entry)
  8. 1374009Domain d2zqbb_: 2zqb B: [171422]
    automated match to d1rbra_
    complexed with so4; mutant

Details for d2zqbb_

PDB Entry: 2zqb (more details), 2.49 Å

PDB Description: crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations
PDB Compounds: (B:) ribonuclease hi

SCOPe Domain Sequences for d2zqbb_:

Sequence, based on SEQRES records: (download)

>d2zqbb_ c.55.3.1 (B:) automated matches {Shewanella oneidensis [TaxId: 70863]}
lklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealke
pckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrwv
kghaghaenerchqlaraaaeanptqidtgy

Sequence, based on observed residues (ATOM records): (download)

>d2zqbb_ c.55.3.1 (B:) automated matches {Shewanella oneidensis [TaxId: 70863]}
lklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealke
pckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrwv
kgaenerchqlaraaaeanptqidtgy

SCOPe Domain Coordinates for d2zqbb_:

Click to download the PDB-style file with coordinates for d2zqbb_.
(The format of our PDB-style files is described here.)

Timeline for d2zqbb_: