Lineage for d2zpoa_ (2zpo A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635602Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 1635603Protein automated matches [190767] (5 species)
    not a true protein
  7. 1635604Species Chelonia mydas [TaxId:8469] [188572] (1 PDB entry)
  8. 1635605Domain d2zpoa_: 2zpo A: [171405]
    automated match to d1k5ba_
    complexed with gol, so4

Details for d2zpoa_

PDB Entry: 2zpo (more details), 1.6 Å

PDB Description: Crystal Structure of Green Turtle Egg White Ribonuclease
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2zpoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpoa_ d.5.1.0 (A:) automated matches {Chelonia mydas [TaxId: 8469]}
etryekflrqhvdyprtaapdtrtycnqmmqrrgmtlpvckftntfvhasaasitticgp
ggapaggnlrdstasfalttcrlqggsqrppcnynggtstqririacdgglpvhydrai

SCOPe Domain Coordinates for d2zpoa_:

Click to download the PDB-style file with coordinates for d2zpoa_.
(The format of our PDB-style files is described here.)

Timeline for d2zpoa_: