PDB entry 2zpo

View 2zpo on RCSB PDB site
Description: Crystal Structure of Green Turtle Egg White Ribonuclease
Class: hydrolase
Keywords: Green Turtle Egg White Ribonuclease, Endonuclease, Hydrolase, Nuclease
Deposited on 2008-07-25, released 2008-08-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Chelonia mydas [TaxId:8469]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84844 (0-118)
      • see remark 999 (36)
    Domains in SCOPe 2.04: d2zpoa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zpoA (A:)
    etryekflrqhvdyprtaapdtrtycnqmmqrrgmtlpvckftntfvhasaasitticgp
    ggapaggnlrdstasfalttcrlqggsqrppcnynggtstqririacdgglpvhydrai