Lineage for d2zg9x_ (2zg9 X:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484440Protein (Apo)ferritin [47246] (8 species)
  7. 1484494Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (46 PDB entries)
  8. 1484513Domain d2zg9x_: 2zg9 X: [171203]
    automated match to d1data_
    complexed with cd, edo, pll, so4

Details for d2zg9x_

PDB Entry: 2zg9 (more details), 1.75 Å

PDB Description: crystal structure of pd(allyl)/apo-h114afr
PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d2zg9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zg9x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlaalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh

SCOPe Domain Coordinates for d2zg9x_:

Click to download the PDB-style file with coordinates for d2zg9x_.
(The format of our PDB-style files is described here.)

Timeline for d2zg9x_: