Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
Protein Transcriptional regulator TTHA1359, C-terminal domain [140233] (1 species) |
Species Thermus thermophilus [TaxId:274] [140234] (1 PDB entry) Uniprot Q5SIL0 118-199 |
Domain d2zcwa1: 2zcw A:117-198 [171157] Other proteins in same PDB: d2zcwa2 complexed with mpd |
PDB Entry: 2zcw (more details), 1.5 Å
SCOPe Domain Sequences for d2zcwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcwa1 a.4.5.4 (A:117-198) Transcriptional regulator TTHA1359, C-terminal domain {Thermus thermophilus [TaxId: 274]} rlknrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyir sgygkiqlldlkglkelaesrg
Timeline for d2zcwa1: