Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (13 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [188184] (2 PDB entries) |
Domain d2zc7c_: 2zc7 C: [171153] automated match to d1blsa_ |
PDB Entry: 2zc7 (more details), 2.4 Å
SCOPe Domain Sequences for d2zc7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc7c_ e.3.1.1 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]} pmsekqlaevvertvtplmkaqaipgmavaviyegqphyftfgkadvaankpvtpqtlfe lgsisktftgvlggdaiargeislgdpvtkywpeltgkqwqgirmldlatytagglplqv pdevkdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmsyeqaittrvfkp lkldhtwinvpkaeeahyawgyrdgkavhvspgmldaeaygvktnvqdmaswvmvnmkpd slqdnslrkgltlaqsrywrvgamyqglgwemlnwpvdaktvvegsdnkvalaplparev nppappvnaswvhktgstggfgsyvafipekqlgivmlanksypnparveaayrilsal
Timeline for d2zc7c_: