Lineage for d2z37b_ (2z37 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171120Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2171128Protein automated matches [190455] (7 species)
    not a true protein
  7. 2171129Species Brassica juncea [TaxId:3707] [187370] (3 PDB entries)
  8. 2171131Domain d2z37b_: 2z37 B: [171021]
    automated match to d2baaa_

Details for d2z37b_

PDB Entry: 2z37 (more details), 1.53 Å

PDB Description: crystal structure of brassica juncea chitinase catalytic module (bjchi3)
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d2z37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z37b_ d.2.1.1 (B:) automated matches {Brassica juncea [TaxId: 3707]}
dlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkeiaaf
fgqtshettggwsgapdgantwgycykeeidksdphcdsnnlewpcapgkfyygrgpmml
swnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqweps
aadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidcdnq
rpfn

SCOPe Domain Coordinates for d2z37b_:

Click to download the PDB-style file with coordinates for d2z37b_.
(The format of our PDB-style files is described here.)

Timeline for d2z37b_: