Class a: All alpha proteins [46456] (289 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
Protein automated matches [190594] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries) |
Domain d2z0vb_: 2z0v B: [170962] automated match to d1x03a1 |
PDB Entry: 2z0v (more details), 2.49 Å
SCOPe Domain Sequences for d2z0vb_:
Sequence, based on SEQRES records: (download)
>d2z0vb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk dlkeighhlkklegrrldydykkkrvgkipdeevrqavekfeeskelaersmfnflendv eqvsqlavfieaaldyhrqsteilqelqsklqmrisaassvprre
>d2z0vb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk dlkeighhlkklegrrldydykkkrvgeevrqavekfeeskelaersmfnflendveqvs qlavfieaaldyhrqsteilqelqsklqmrisaassvprre
Timeline for d2z0vb_: