SCOPe 2.07: Domain d2z0va_: 2z0v A:

Lineage for d2z0va_ (2z0v A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein automated matches [190594] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries)

8. Domain d2z0va_: 2z0v A: [170961]
   automated match to d1x03a1

Details for d2z0va_

PDB Entry: 2z0v, 2.49 Å

PDB Description: Crystal structure of BAR domain of Endophilin-III

PDB Compounds: (A:) SH3-containing GRB2-like protein 3

SCOPe Domain Sequences for d2z0va_:

Sequence; same for both SEQRES and ATOM records:

>d2z0va_ a.238.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt
egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk
dlkeighhlkklegrrldydykkkrvgkipdeevrqavekfeeskelaersmfnflendv
eqvsqlavfieaaldyhrqsteilqelqsklqmrisaassvpr

Timeline for d2z0va_:

• d2z0va_ first appeared in SCOPe 2.01
  
• d2z0va_ appears in SCOPe 2.06
  
• d2z0va_ appears in the current release, SCOPe 2.08