Lineage for d2yzhc1 (2yzh C:1-168)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2133916Species Aquifex aeolicus [TaxId:224324] [188265] (2 PDB entries)
  8. 2133919Domain d2yzhc1: 2yzh C:1-168 [170942]
    Other proteins in same PDB: d2yzha2, d2yzhb2, d2yzhc2, d2yzhd2
    automated match to d1psqa_
    complexed with so4

Details for d2yzhc1

PDB Entry: 2yzh (more details), 1.85 Å

PDB Description: Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus
PDB Compounds: (C:) Probable thiol peroxidase

SCOPe Domain Sequences for d2yzhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzhc1 c.47.1.0 (C:1-168) automated matches {Aquifex aeolicus [TaxId: 224324]}
martvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldtpv
cetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekygvl
igegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel

SCOPe Domain Coordinates for d2yzhc1:

Click to download the PDB-style file with coordinates for d2yzhc1.
(The format of our PDB-style files is described here.)

Timeline for d2yzhc1: