SCOPe 2.05: Domain d2y8qb_: 2y8q B:

Lineage for d2y8qb_ (2y8q B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)
   automatically mapped to Pfam PF04739

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein automated matches [190789] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries)

8. Domain d2y8qb_: 2y8q B: [170700]
   Other proteins in same PDB: d2y8qa_, d2y8qe1, d2y8qe2
   automated match to d2v8qb1
   complexed with adp, amp

Details for d2y8qb_

PDB Entry: 2y8q, 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP

PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2y8qb_:

Sequence, based on SEQRES records:

>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records):

>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdpnhvmlnhlyalsikdsvmvlsathrykk
kyvttllykpi

Timeline for d2y8qb_:

• d2y8qb_ first appeared in SCOPe 2.01
  
• d2y8qb_ appears in SCOPe 2.04
  
• d2y8qb_ appears in SCOPe 2.06
  
• d2y8qb_ appears in the current release, SCOPe 2.08