Lineage for d2y88a_ (2y88 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143707Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
  6. 1143740Protein automated matches [190186] (3 species)
    not a true protein
  7. 1143741Species Mycobacterium tuberculosis [TaxId:83332] [189657] (4 PDB entries)
  8. 1143742Domain d2y88a_: 2y88 A: [170687]
    automated match to d1vzwa1
    complexed with 2er

Details for d2y88a_

PDB Entry: 2y88 (more details), 1.33 Å

PDB Description: crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d2y88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y88a_ c.1.2.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mplillpavnvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg
snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh
gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp
nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala
avrd

SCOPe Domain Coordinates for d2y88a_:

Click to download the PDB-style file with coordinates for d2y88a_.
(The format of our PDB-style files is described here.)

Timeline for d2y88a_: