SCOPe 2.05: Domain d2xsna_: 2xsn A:

Lineage for d2xsna_ (2xsn A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
   unusual fold

4. Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family)

5. Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)

6. Protein automated matches [191203] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189544] (3 PDB entries)

8. Domain d2xsna_: 2xsn A: [170360]
   automated match to d1toha_
   complexed with zn

Details for d2xsna_

PDB Entry: 2xsn, 2.68 Å

PDB Description: crystal structure of human tyrosine hydroxylase catalytic domain

PDB Compounds: (A:) tyrosine 3-monooxygenase

SCOPe Domain Sequences for d2xsna_:

Sequence; same for both SEQRES and ATOM records:

>d2xsna_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvpwfprkvseldkchhlvtkfdpdldldhpgfsdqvyrqrrkliaeiafqyrhgdpipr
veytaeeiatwkevyttlkglyathacgehleafallerfsgyrednipqledvsrflke
rtgfqlrpvagllsardflaslafrvfqctqyirhasspmhspepdcchellghvpmlad
rtfaqfsqdiglaslgasdeeieklstlywftvefglckqngevkaygagllssygellh
clseepeirafdpeaaavqpyqdqtyqsvyfvsesfsdakdklrsyasriqrpfsvkfdp
ytlaidvldspqavrrslegvqdeldtlahalsai

Timeline for d2xsna_:

• d2xsna_ first appeared in SCOPe 2.01
  
• d2xsna_ appears in SCOPe 2.04
  
• d2xsna_ appears in SCOPe 2.06
  
• d2xsna_ appears in the current release, SCOPe 2.08