Lineage for d2xr8n_ (2xr8 N:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896464Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1896520Protein automated matches [190223] (4 species)
    not a true protein
  7. 1896521Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries)
  8. 1896558Domain d2xr8n_: 2xr8 N: [170310]
    Other proteins in same PDB: d2xr8a1, d2xr8a2, d2xr8c1, d2xr8c2, d2xr8e1, d2xr8e2, d2xr8g1, d2xr8g2, d2xr8i1, d2xr8i2, d2xr8k1, d2xr8k2, d2xr8m1, d2xr8m2, d2xr8o1, d2xr8o2, d2xr8q1, d2xr8q2, d2xr8s1, d2xr8s2, d2xr8u1, d2xr8u2, d2xr8w1, d2xr8w2
    automated match to d1wqlb1
    complexed with fe2, fes

Details for d2xr8n_

PDB Entry: 2xr8 (more details), 2.49 Å

PDB Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (N:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xr8n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xr8n_ d.17.4.4 (N:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2xr8n_:

Click to download the PDB-style file with coordinates for d2xr8n_.
(The format of our PDB-style files is described here.)

Timeline for d2xr8n_: