SCOPe 2.05: Domain d2xe3b_: 2xe3 B:

Lineage for d2xe3b_ (2xe3 B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187889] (6 PDB entries)

8. Domain d2xe3b_: 2xe3 B: [170053]
   automated match to d1osma_
   complexed with bog

Details for d2xe3b_

PDB Entry: 2xe3, 2.85 Å

PDB Description: ompc28

PDB Compounds: (B:) outer membrane porin c

SCOPe Domain Sequences for d2xe3b_:

Sequence; same for both SEQRES and ATOM records:

>d2xe3b_ f.4.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
atrvgslgwankaqnfeavaqyqfdfglrpflaylqskgknlgrgyddedilkyvdvgat
yyfnknmstyvdykinllddnrftrdagintddivalglvyqf

Timeline for d2xe3b_:

• d2xe3b_ first appeared in SCOPe 2.01
  
• d2xe3b_ appears in SCOPe 2.04
  
• d2xe3b_ appears in SCOPe 2.06
  
• d2xe3b_ appears in the current release, SCOPe 2.08