Lineage for d2x0rb1 (2x0r B:22-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105845Protein Malate dehydrogenase [51849] (13 species)
  7. 2105898Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)
  8. 2105906Domain d2x0rb1: 2x0r B:22-162 [169772]
    Other proteins in same PDB: d2x0ra2, d2x0rb2
    complexed with cl, na, nad; mutant

Details for d2x0rb1

PDB Entry: 2x0r (more details), 2.92 Å

PDB Description: r207s, r292s mutant of malate dehydrogenase from the halophilic archeon haloarcula marismortui (holoform)
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2x0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0rb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

SCOPe Domain Coordinates for d2x0rb1:

Click to download the PDB-style file with coordinates for d2x0rb1.
(The format of our PDB-style files is described here.)

Timeline for d2x0rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x0rb2