Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries) |
Domain d2x0rb1: 2x0r B:22-162 [169772] Other proteins in same PDB: d2x0ra2, d2x0rb2 complexed with cl, na, nad; mutant |
PDB Entry: 2x0r (more details), 2.92 Å
SCOPe Domain Sequences for d2x0rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0rb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]} tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn pvdllnrhlyeagdrsreqvig
Timeline for d2x0rb1: