SCOPe 2.02: Domain d2wv4b_: 2wv4 B:

Lineage for d2wv4b_ (2wv4 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12112] [189099] (2 PDB entries)

8. Domain d2wv4b_: 2wv4 B: [169652]
   automated match to d2j92a1

Details for d2wv4b_

PDB Entry: 2wv4, 2.5 Å

PDB Description: crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction

PDB Compounds: (B:) picornain 3c

SCOPe Domain Sequences for d2wv4b_:

Sequence, based on SEQRES records:

>d2wv4b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12112]}
tdlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaekydkimldgramtds
dyrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvg
rlifsgealtykdivvlmdgdtmpglfaykaatragyaggavlakdgadtfivgthsagg
ngvgycscvsrsmlqkmkahvd

Sequence, based on observed residues (ATOM records):

>d2wv4b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12112]}
tdlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaekydkimldgramtds
dyrvfefeikvkmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrli
fsgealtykdivvlmdgdtmpglfaykaatragyaggavlaadtfivgthsaggngvgyc
scvsrsmlqkmkahvd

Timeline for d2wv4b_:

• d2wv4b_ first appeared in SCOPe 2.01
  
• d2wv4b_ appears in SCOPe 2.03
  
• d2wv4b_ appears in the current release, SCOPe 2.08