Lineage for d2wrsb_ (2wrs B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231424Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)
  8. 2231479Domain d2wrsb_: 2wrs B: [169603]
    automated match to d1ko2a_
    complexed with cit, flc, zn

Details for d2wrsb_

PDB Entry: 2wrs (more details), 2.79 Å

PDB Description: Crystal Structure of the Mono-Zinc Metallo-beta-lactamase VIM-4 from Pseudomonas aeruginosa
PDB Compounds: (B:) beta-lactamase vim-4

SCOPe Domain Sequences for d2wrsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrsb_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavhelsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

SCOPe Domain Coordinates for d2wrsb_:

Click to download the PDB-style file with coordinates for d2wrsb_.
(The format of our PDB-style files is described here.)

Timeline for d2wrsb_: